GH Axis · Placeholder catalog data
IGF-1 LR3
Also known as Long R3 IGF-1
A long R3 analog of insulin-like growth factor 1 used in laboratory research on IGF-1 receptor signaling, binding-protein interactions, and growth-factor pathway models.
320 credits
Paid from your credit pool at checkout. Bulk quantities discount automatically.
Available variants
Pricing and fulfillment information is placeholder data.
| Amount | SKU | Credits | MSRP | Availability | Margin estimate |
|---|---|---|---|---|---|
| 1 mg | PTS-IGF-1 | 64 credits | $129 | Ready | 50% estimate |
Margin estimate treats 1 credit as $1 and compares estimated wholesale credit cost with placeholder MSRP. It excludes shipping, taxes, and other costs.
Buy more, save more
Quantity breaks apply per line item and are deducted automatically at checkout.
| Quantity per line | Discount | Example (1 mg unit) |
|---|---|---|
| 10+ units | 5% off | 10 × 64 credits → 608 credits |
| 25+ units | 10% off | 25 × 64 credits → 1,440 credits |
| 50+ units | 15% off | 50 × 64 credits → 2,720 credits |
| 100+ units | 20% off | 100 × 64 credits → 5,120 credits |
Specifications
- Formula
- C400H625N111O115S9
- Molecular weight
- 9111 g/mol
- Sequence
- MFPAMPLSSLFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQ
- Purity
- ≥99%
- Appearance
- White lyophilized powder
- Storage
- Store lyophilized at −20 °C, protected from light and moisture
Quality record
COA status
COA listedLot PTS-IGF-2607
Placeholder reference. Verify the active lot before ordering.
Research background
IGF-1 LR3 is an engineered IGF-1 analog with an N-terminal extension and R3 substitution used in research to reduce binding affinity for IGF-binding proteins relative to native IGF-1.
The compound is used in cell-culture and pathway studies involving IGF-1 receptor activation, downstream PI3K/AKT and MAPK signaling, and growth-factor biology.
Supplied exclusively as a research reagent.
Mechanism: Literature describes IGF-1 analogs as ligands for IGF-1 receptor pathway research, with LR3 modifications studied for altered binding-protein interaction profiles.
Research use only
For research use only. Not for human or veterinary use.